Novus Biologicals
Manufacturer Code:NBP257783
Catalog # NBP257783
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 21 kDa TBP-like protein; 21 kDa TBP-like protein STUD21-kDA TBP-like protein TATA box binding protein-related factor 2 TATA box-binding protein-like protein 1 TATA box-binding protein-related factor 2 TBP-like 1 TBP-like factor TBP-like protein 1 TBP-related factor 2 TBP-related protein TLFMGC:8389 TLP21 TLPMGC:9620 TRF2Second TBP of unique DNA protein TRP; 21-kDA TBP-like protein; Second TBP of unique DNA protein; STUD; TATA box-binding protein-like 1; TATA box-binding protein-related factor 2; TBP-like 1; TBP-like factor; TBP-related factor 2; TBP-related protein
Gene Aliases: MGC:8389; MGC:9620; STUD; TBPL1; TLF; TLP; TLP21; TRF2; TRP
UniProt ID: (Human) P62380
Entrez Gene ID: (Human) 9519
Molecular Function:
nucleic acid binding
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.