Invitrogen
Manufacturer Code:PA129834
Catalog # PIPA129834
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | synthetic peptide WPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWT corresponding to amino acids 200-250 of Human TBLR1. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4°C short term. For long term storage store at -20°C avoiding freeze/thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C21 DC42 FLJ12894 IRA1 TBLR1; F-box-like/WD repeat protein TBL1XR1; F-box-like/WD repeat-containing protein TBL1XR1; nuclear receptor co-repressor/HDAC3 complex subunit; Nuclear receptor corepressor/HDAC3 complex subunit TBLR1; TBL1-related protein 1; Transducin beta-like 1X-related protein 1
Gene Aliases: 8030499H02Rik; A630076E03Rik; AW539987; C21; C230089I12Rik; DC42; IRA1; MRD41; RGD1560053; TBL1XR1; TBLR1
UniProt ID: (Human) Q9BZK7, (Mouse) Q8BHJ5
Entrez Gene ID: (Human) 79718, (Rat) 365755, (Mouse) 81004
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.