Novus Biologicals
Manufacturer Code:NBP238189
Catalog # NBP238189
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 45/50kDa FLJ32821 II Protein taube nuss RNA polymerase II 43 kD TAF(II)4343 TAF8 RNA polymerase II TATA box binding protein (TBP)-associated factor 43kDa TATA box binding protein (TBP)-associated factor RNA polymerase II A taube nuss homolog (mouse) TBP-associated factor 43 kDa TBP-associated factor 8 transcription initiation factor TFIID subunit 8; hTAFII43; Protein taube nuss; TAF(II)43; TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa; TAFII-43; TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 45/50kDa; TATA box binding protein associated factor 8; taube nuss homolog; TBP-associated factor 43 kDa; TBP-associated factor 8; TBP-associated factor TAFII43; TBP-associated factor, RNA polymerase II, 43 kD; Transcription initiation factor TFIID 43 kDa subunit; Transcription initiation factor TFIID subunit 8
Gene Aliases: II; TAF; TAF8; TAFII-43; TAFII43; TBN
UniProt ID: (Human) Q7Z7C8
Entrez Gene ID: (Human) 129685
Molecular Function:
DNA binding protein
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.