Novus Biologicals
Manufacturer Code:NBP239083
Catalog # NBP239083
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ11136 p300/CBP-associated factor (PCAF)-associated factor 65 PAF65-alpha PAF65AMGC4288 PCAF-associated factor 65 alpha PCAF-associated factor 65-alpha TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDasubunit 6L TAF6-like RNA polymerase II p300/CBP-associated factor (PCAF)-associatedfactor 65 kD TAF6-like RNA polymerase II p300/CBP-associated factor (PCAF)-associatedfactor 65kDa; p300/CBP-associated factor (PCAF)-associated factor 65; PAF65-alpha; PCAF-associated factor 65 alpha; PCAF-associated factor 65-alpha; TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L; TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa; TAF6L; TATA box binding protein associated factor 6 like
Gene Aliases: PAF65A; TAF6L
UniProt ID: (Human) Q9Y6J9
Entrez Gene ID: (Human) 10629
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.