Novus Biologicals
Manufacturer Code:NBP257546
Catalog # NBP257546
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: PAF65-beta; PAF65BPAF65-beta PCAF associated factor 65 beta PCAF-associated factor 65 beta TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDasubunit 5L TAF5-like RNA polymerase II p300/CBP-associated factor (PCAF)-associatedfactor 65 kD TAF5-like RNA polymerase II p300/CBP-associated factor (PCAF)-associatedfactor 65kDa; PCAF associated factor 65 beta; PCAF-associated factor 65 beta; TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L; TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa; TAF5L; TATA box binding protein associated factor 5 like
Gene Aliases: PAF65B; TAF5L
UniProt ID: (Human) O75529
Entrez Gene ID: (Human) 27097
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.