Novus Biologicals
Manufacturer Code:NBP257720
Catalog # NBP257720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 68 kDa TATA-binding protein-associated factor; 68kDa hTAFII68 Npl3 RBP56TAFII68 RNA-binding protein 56 TAF(II)68 TAF15 RNA polymerase II TATA box binding protein (TBP)-associated factor TAF2NRBP56/CSMF fusion TATA box binding protein (TBP)-associated factor RNA polymerase II N 68kD(RNA-binding protein 56) TATA box-binding protein-associated factor 2N (RNA-binding protein 56) TATA-binding protein-associated factor 2N TBP-associated factor 1568 kDa TATA-binding protein-associated factor; RBP56/CSMF fusion; RNA-binding protein 56; TAF(II)68; TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa; TATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD (RNA-binding protein 56); TATA box binding protein associated factor 15; TATA box-binding protein-associated factor 2N (RNA-binding protein 56); TATA-binding protein-associated factor 2N; TBP-associated factor 15
Gene Aliases: Npl3; RBP56; TAF15; TAF2N; TAFII68
UniProt ID: (Human) Q92804
Entrez Gene ID: (Human) 8148
Molecular Function:
DNA binding protein
RNA binding protein
mRNA processing factor
mRNA splicing factor
nucleic acid binding
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.