Novus Biologicals
Manufacturer Code:NBP15662920UL
Catalog # NBP15662920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TADA1L(transcriptional adaptor 1 (HFI1 homolog yeast)-like) The peptide sequence was selected from the C terminal of TADA1L (NP_444281). Peptide sequence REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADA1 hADA1 HFI1 SPT3-associated factor 42 SPT3-associated factor 42 (STAF42) STAF42transcriptional adaptor 1 (HFI1 homolog yeast)-like TADA1LRP1-9E21.4 transcriptional adapter 1 Transcriptional adapter 1-like protein transcriptional adaptor 1 transcriptional adaptor 1 (HFI1 homolog yeast); SPT3-associated factor 42; SPT3-associated factor 42 (STAF42); STAF42; Transcriptional adapter 1; Transcriptional adapter 1-like protein; transcriptional adaptor 1 (HFI1 homolog, yeast)
Gene Aliases: ADA1; hADA1; HFI1; STAF42; TADA1; TADA1L
UniProt ID: (Human) Q96BN2
Entrez Gene ID: (Human) 117143
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.