Novus Biologicals
Manufacturer Code:NBP169132
Catalog # NBP169132
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TAAR5 (trace amine associated receptor 5) The peptide sequence was selected from the middle region of TAAR5. Peptide sequence GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hTaar5; MGC138414 MGC138416 PNRRP11-295F4.5 Putative neurotransmitter receptor taR-5 trace amine associated receptor 5 Trace amine receptor 5 trace amine-associated receptor 5; Putative neurotransmitter receptor; TaR-5; trace amine receptor 5; Trace amine-associated receptor 5
Gene Aliases: PNR; TAAR5
UniProt ID: (Human) O14804
Entrez Gene ID: (Human) 9038
Molecular Function: G-protein coupled receptor receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.