Novus Biologicals
Manufacturer Code:NBP16917920UL
Catalog # NBP16917920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to STX4 (syntaxin 4) The peptide sequence was selected from the C terminal of STX4. Peptide sequence VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Renal carcinoma antigen NY-REN-31; Renal carcinoma antigen NY-REN-31 STX4Ap35-2 syntaxin 4 syntaxin 4A (placental) syntaxin-4; syntaxin 4A (placental); Syntaxin-4
Gene Aliases: p35-2; STX4; STX4A
UniProt ID: (Human) Q12846
Entrez Gene ID: (Human) 6810
Molecular Function:
SNARE protein
membrane traffic protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.