Novus Biologicals
Manufacturer Code:NBP15736820UL
Catalog # NBP15736820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SYNJ1(synaptojanin 1) The peptide sequence was selected from the middle region of SYNJ1. Peptide sequence PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.1.3 EC 3.1.3.36 KIAA0910 polyphosphoinositide phosphatase 10synaptojanin-1 Synaptic inositol-145-trisphosphate 5-phosphatase 1 synaptojanin 1; inositol 5'-phosphatase (synaptojanin 1); inositol polyphosphate-5-phosphatase G; phosphoinositide 5-phosphatase; Synaptic inositol 1,4,5-trisphosphate 5-phosphatase 1; synaptic inositol-1,4,5-trisphosphate 5-phosphatase 1; Synaptojanin-1; synaptojanin-1, polyphosphoinositide phosphatase
Gene Aliases: INPP5G; KIAA0910; PARK20; SYNJ1
UniProt ID: (Human) O43426
Entrez Gene ID: (Human) 8867
Molecular Function:
hydrolase
phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.