Novus Biologicals
Manufacturer Code:NBP186992
Catalog # NBP186992
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TCVLAGMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKSIINQVLSQTQVDFAN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cholesterol trafficker; cholesterol trafficker mitochondrial steroid acute regulatory protein StAR StARD1 STARD1StAR-related lipid transfer (START) domain containing 1 START domain containing 1 START domain-containing protein 1 steroid acute regulatory protein steroidogenic acute regulator steroidogenic acute regulatory protein steroidogenic acute regulatory protein mitochondrial; mitochondrial steroid acute regulatory protein; StAR; StAR related lipid transfer (START) domain containing 1; StAR-related lipid transfer (START) domain containing 1; StARD1; START domain containing 1; START domain-containing protein 1; steroid acute regulatory protein; steroidogenic acute regulator; Steroidogenic acute regulatory protein, mitochondrial; testis secretory sperm-binding protein Li 241mP
Gene Aliases: STAR; STARD1
UniProt ID: (Human) P49675
Entrez Gene ID: (Human) 6770
Molecular Function:
membrane traffic protein
transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.