Novus Biologicals
Manufacturer Code:NBP238165
Catalog # NBP238165
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: c-src EC 2.7.10 EC 2.7.10.2 pp60c-src Rous sarcoma tyrosine kinase pp60c-src tyrosine-protein kinase SRC-1 v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian); p60-Src; pp60c-src; Proto-oncogene c-Src; Proto-oncogene tyrosine-protein kinase Src; protooncogene SRC, Rous sarcoma; tyrosine kinase pp60c-src; tyrosine-protein kinase SRC-1; v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog
Gene Aliases: ASV; c-SRC; p60-Src; SRC; SRC1; THC6
UniProt ID: (Human) P12931
Entrez Gene ID: (Human) 6714
Molecular Function: kinase non-receptor tyrosine protein kinase protein kinase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.