Novus Biologicals
Manufacturer Code:NBP153181
Catalog # NBP153181
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SGPP2(sphingosine-1-phosphate phosphotase 2) The peptide sequence was selected from the C terminal of SGPP2. Peptide sequence SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.1.3 EC 3.1.3.- FLJ39004 hSPP2 sphingosine 1-phosphate phosphohydrolase 2 Sphingosine-1-phosphatase 2 sphingosine-1-phosphate phosphatase 2 Spp2 SPP2sphingosine-1-phosphate phosphotase 2 SPPase2; sphingosine 1-phosphate phosphohydrolase 2; Sphingosine-1-phosphatase 2; Sphingosine-1-phosphate phosphatase 2; sphingosine-1-phosphate phosphotase 2; SPPase2
Gene Aliases: SGPP2; SPP2; SPPase2
UniProt ID: (Human) Q8IWX5
Entrez Gene ID: (Human) 130367
Molecular Function: hydrolase phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.