Novus Biologicals
Manufacturer Code:NBP160081
Catalog # NBP160081
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SGMS1(sphingomyelin synthase 1) The peptide sequence was selected from the middle region of SGMS1 (NP_671512). Peptide sequence SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Medulla oblongata-derived protein; MGC17342 MOBProtein Mob phosphatidylcholine:ceramide cholinephosphotransferase 1 SMS1EC 2.7.8.27 sphingomyelin synthase 1Medulla oblongata-derived protein TMEM23hmob33 Transmembrane protein 23MOB1; Phosphatidylcholine:ceramide cholinephosphotransferase 1; Protein Mob; Sphingomyelin synthase 1; Transmembrane protein 23
Gene Aliases: hmob33; MOB; MOB1; SGMS1; SMS1; TMEM23
UniProt ID: (Human) Q86VZ5
Entrez Gene ID: (Human) 259230
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.