Novus Biologicals
Manufacturer Code:NBP238461
Catalog # NBP238461
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LGTITFEQYMQAGLWFTGDEDIKIPENPLEPLPFNRQEHLIEFFFRLFADYEKDPPQLDYTQMLLYFACHPDTVEGVYRALSVAVGTHVFQQVKA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cancer/testis antigen 122; cancer/testis antigen 122 CT122 FLJ23164 FLJ23577 FLJ25395 KIAA1770 KPL2MGC102842 Protein KPL2 sperm flagellar 2 sperm flagellar protein 2; Protein KPL2; Sperm flagellar protein 2; testis tissue sperm-binding protein Li 47a
Gene Aliases: CT122; KIAA1770; KPL2; SPEF2
UniProt ID: (Human) Q9C093
Entrez Gene ID: (Human) 79925
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.