Novus Biologicals
Manufacturer Code:NBP160034
Catalog # NBP160034
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC22A18(solute carrier family 22 member 18) The peptide sequence was selected from the middle region of SLC22A18. Peptide sequence IQCPAILAALATLLGAVLSFTCIPASTKGAKTDAQAPLPGGPRASVFDLK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene A protein; BWR1AORCTL2 BWSCR1Asolute carrier family 22 (organic cation transporter) member 1-like Efflux transporter-like protein HET imprinted multi-membrane spanning polyspecific transporter-related protein 1 Imprinted multi-membrane-spanning polyspecific transporter-related protein 1 IMPT1DKFZp667A184 ITMp45-BWR1A ORCTL-2 organic cation transporter-like 2 Organic cation transporter-like protein 2 p45 Beckwith-Wiedemann region 1A SLC22A1Lcandidate A solute carrier family 22 member 18 Solute carrier family 22 member 1-like solute carrier family 22 member 18 TSSC5p45-Beckwith-Wiedemann region 1 A Tumor-suppressing STF cDNA 5 protein Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein; Efflux transporter-like protein; Imprinted multi-membrane-spanning polyspecific transporter-related protein 1; ORCTL-2; Organic cation transporter-like protein 2; p45 Beckwith-Wiedemann region 1A; p45-Beckwith-Wiedemann region 1 A; p45-BWR1A; Solute carrier family 22 member 1-like; Solute carrier family 22 member 18; solute carrier family 22, member 18; Tumor-suppressing STF cDNA 5 protein; Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Gene Aliases: BWR1A; BWSCR1A; HET; IMPT1; ITM; ORCTL2; p45-BWR1A; SLC22A18; SLC22A1L; TSSC5
UniProt ID: (Human) O60680
Entrez Gene ID: (Human) 5002
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.