Novus Biologicals
Manufacturer Code:NBP169515
Catalog # NBP169515
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC8A3(solute carrier family 8 (sodium-calcium exchanger) member 3) The peptide sequence was selected from the N terminal of Sodium-Calcium Exchanger. Peptide sequence SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Na(+)/Ca(2+)-exchange protein 3; Na(+)/Ca(2+)-exchange protein 3 Na+/Ca2+ exchanger 3 NCX3sodium/calcium exchanger SLC8A3 sodium/calcium exchanger 3 solute carrier family 8 (sodium/calcium exchanger) member 3 solute carrier family 8 (sodium-calcium exchanger) member 3; Sodium/calcium exchanger 3; sodium/calcium exchanger SLC8A3; solute carrier family 8 (sodium/calcium exchanger), member 3; Solute carrier family 8 member 3
Gene Aliases: NCX3; SLC8A3
UniProt ID: (Human) P57103
Entrez Gene ID: (Human) 6547
Molecular Function:
cation transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.