Novus Biologicals
Manufacturer Code:NBP256483
Catalog # NBP256483
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ37694 FLJ43417 Na(+)/Ca(2+)-exchange protein 1 sodium/calcium exchanger 1 solute carrier family 8 (sodium/calcium exchanger) member 1; Na(+)/Ca(2+)-exchange protein 1; Na+/Ca++ exchanger; Na+/Ca2+ exchanger; Sodium/calcium exchanger 1; solute carrier family 8 (sodium/calcium exchanger), member 1; Solute carrier family 8 member 1
Gene Aliases: CNC; NCX1; SLC8A1
UniProt ID: (Human) P32418
Entrez Gene ID: (Human) 6546
Molecular Function:
cation transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.