Novus Biologicals
Manufacturer Code:NBP213361
Catalog # NBP213361
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RLGAAMMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: MGC3157 MSTP010 sorting nexin 6 sorting nexin-6 TFAF2 TRAF4-associated factor 2 tumor necrosis factor receptor-associated factor 4(TRAF4)-associated factor 2; Sorting nexin-6; Sorting nexin-6, N-terminally processed; TRAF4-associated factor 2; tumor necrosis factor receptor-associated factor 4(TRAF4)-associated factor 2
Gene Aliases: MSTP010; SNX6; TFAF2
UniProt ID: (Human) Q9UNH7
Entrez Gene ID: (Human) 58533
Molecular Function:
membrane traffic protein
membrane trafficking regulatory protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.