Novus Biologicals
Manufacturer Code:NBP180022
Catalog # NBP180022
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human SNAI1. Peptide sequence MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Protein sna; Protein sna Protein snail homolog 1 SLUGH2 SNA SNAHdJ710H13.1 snail 1 (drosophila homolog) zinc finger protein snail 1 homolog snail 1 zinc finger protein snail 1 zinc finger protein snail homolog 1 (Drosophila) zinc finger protein SNAI1; Protein snail homolog 1; snail 1 homolog; snail 1 zinc finger protein; snail 1, zinc finger protein; snail family zinc finger 1; snail homolog 1; Zinc finger protein SNAI1
Gene Aliases: dJ710H13.1; SLUGH2; SNA; SNAH; SNAI1; SNAIL; SNAIL1
UniProt ID: (Human) O95863
Entrez Gene ID: (Human) 6615
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.