Novus Biologicals
Manufacturer Code:NBP159140
Catalog # NBP159140
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLIT3(slit homolog 3 (Drosophila)) The peptide sequence was selected from the N terminal of SLIT3 (NP_003053). Peptide sequence PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: KIAA0814 MEGF5Multiple epidermal growth factor-like domains protein 5 Multiple EGF-like domains protein 5 SLIL2 SLIL2FLJ10764 slit homolog 3 (Drosophila) slit homolog 3 protein SLIT1 slit2 Slit-3slit (Drosophila) homolog 3; Multiple EGF-like domains protein 5; Multiple epidermal growth factor-like domains protein 5; slit homolog 3; Slit homolog 3 protein; Slit-3
Gene Aliases: KIAA0814; MEGF5; SLIL2; Slit-3; SLIT1; slit2; SLIT3; UNQ691/PRO1336
UniProt ID: (Human) O95804
Entrez Gene ID: (Human) 6586
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.