Novus Biologicals
Manufacturer Code:NBP157539
Catalog # NBP157539
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SARS (seryl-tRNA synthetase) The peptide sequence was selected from the middle region of SARS. Peptide sequence SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 6.1.1.11 FLJ36399 serine-tRNA ligase Serine--tRNA ligase SERRS SERSserine tRNA ligase 1 cytoplasmic Seryl-tRNA Ser/Sec synthetase seryl-tRNA synthetase seryl-tRNA synthetase cytoplasmic Seryl-tRNA(Ser/Sec) synthetase; serine tRNA ligase 1, cytoplasmic; Serine--tRNA ligase, cytoplasmic; SerRS; Seryl-tRNA synthetase; seryl-tRNA synthetase, cytoplasmic; Seryl-tRNA(Ser/Sec) synthetase
Gene Aliases: SARS; SARS1; SERRS; SERS
UniProt ID: (Human) P49591
Entrez Gene ID: (Human) 6301
Molecular Function:
RNA binding protein
aminoacyl-tRNA synthetase
ligase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.