Novus Biologicals
Manufacturer Code:NBP233764
Catalog # NBP233764
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: HC-II; HC2LS2 HCF2clade D (heparin cofactor) member 1 HC-II Heparin cofactor II HLS2HCII leuserpin 2 Protease inhibitor leuserpin-2 Serpin D1 serpin peptidase inhibitor clade D (heparin cofactor) member 1; Heparin cofactor 2; Heparin cofactor II; HLS2; leuserpin 2; Protease inhibitor leuserpin-2; serine (or cysteine) proteinase inhibitor, clade D (heparin cofactor), member 1; Serpin D1; serpin peptidase inhibitor, clade D (heparin cofactor), member 1
Gene Aliases: D22S673; HC2; HCF2; HCII; HLS2; LS2; SERPIND1; THPH10
UniProt ID: (Human) P05546
Entrez Gene ID: (Human) 3053
Molecular Function:
enzyme modulator
protease inhibitor
serine protease inhibitor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.