Novus Biologicals
Manufacturer Code:NBP255358
Catalog # NBP255358
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AF17q25 FLJ75490 KIAA0991Ov/Br septin MLL septin-like fusion protein MLL septin-like fusion protein MSF-A MSF1NAPB MSFMLL septin-like fusion Ovarian/Breast septin PNUTL4 SeptD1 septin 9 Septin D1 septin-9 SINT1; MLL septin-like fusion protein; MLL septin-like fusion protein MSF-A; Ov/Br septin; Ovarian/Breast septin; Septin D1; Septin-9
Gene Aliases: AF17q25; KIAA0991; MSF; MSF1; NAPB; PNUTL4; SEPT9; SeptD1; SEPTIN9; SINT1
UniProt ID: (Human) Q9UHD8
Entrez Gene ID: (Human) 10801
Molecular Function:
G-protein
cytoskeletal protein
enzyme modulator
small GTPase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.