Novus Biologicals
Manufacturer Code:NBP185730
Catalog # NBP185730
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MSVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CDC10 (cell division cycle 10, S. cerevisiae, homolog); CDC10 cell division cycle 10 homolog CDC10 cell division cycle 10 homolog (S. cerevisiae) CDC10 protein homolog CDC10S. cerevisiae homolog) Nbla02942 septin 7 septin-7; CDC10 protein homolog; septin 7 variant 4; Septin-7
Gene Aliases: CDC10; CDC3; NBLA02942; SEPT7; SEPT7A; SEPTIN7
UniProt ID: (Human) Q16181
Entrez Gene ID: (Human) 989
Molecular Function:
G-protein
cytoskeletal protein
enzyme modulator
small GTPase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.