Novus Biologicals
Manufacturer Code:NBP190094
Catalog # NBP190094
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:YDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Apoptosis-related protein in the TGF-beta signaling pathway; Apoptosis-related protein in the TGF-beta signaling pathway ARTSPeanut-like protein 2 BRADEION Bradeion beta Brain protein H5 CE5B3 Cell division control-related protein 2 Cerebral protein 7 H5 hCDCREL-2SEP4 hucep-7 MART peanut-like 2 peanut-like 2 (Drosophila) PNUTL2CE5B3 beta septin 4 septin-4 septin-M; ARTS; Bradeion beta; Brain protein H5; CE5B3 beta; Cell division control-related protein 2; Cerebral protein 7; hCDCREL-2; Peanut-like protein 2; Septin-4; septin-M
Gene Aliases: ARTS; BRADEION; C17orf47; CE5B3; H5; hCDCREL-2; hucep-7; MART; PNUTL2; SEP4; SEPT4; SEPTIN4
UniProt ID: (Human) O43236
Entrez Gene ID: (Human) 5414
Molecular Function:
G-protein
cytoskeletal protein
enzyme modulator
small GTPase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.