Novus Biologicals
Manufacturer Code:NBP158013
Catalog # NBP158013
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SEMG1(semenogelin I) The peptide sequence was selected from the N terminal of SEMG1 (NP_002998). Peptide sequence QKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alpha-inhibin-31; Alpha-inhibin-92; Cancer/testis antigen 103; CT103 dJ172H20.2 FLJ78262 semen coagulating protein semenogelin IMGC14719 semenogelin-1 SEMGcancer/testis antigen 103 SGI; semen coagulating protein; Semenogelin I; Semenogelin-1; Seminal basic protein; SGI; SgI-29
Gene Aliases: CT103; dJ172H20.2; SEMG; SEMG1; SGI
UniProt ID: (Human) P04279
Entrez Gene ID: (Human) 6406
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.