Novus Biologicals
Manufacturer Code:NBP15936920UL
Catalog # NBP15936920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DHCR24(24-dehydrocholesterol reductase) The peptide sequence was selected from the N terminal of DHCR24. Peptide sequence FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 24-dehydrocholesterol reductase; 24-dehydrocholesterol reductaseNbla03646 DCE desmosterol-to-cholesterol enzyme Diminuto/dwarf1 homolog EC 1.3.1.72 KIAA0018SELADIN1 seladin 13-beta-hydroxysterol delta-24-reductase seladin-1 selective AD indicator 13 beta-hydroxysterol delta 24-reductase; 3 beta-hydroxysterol delta 24-reductase; 3-beta-hydroxysterol Delta-24-reductase; Delta(24)-sterol reductase; desmosterol-to-cholesterol enzyme; Diminuto/dwarf1 homolog; seladin 1; Seladin-1; selective AD indicator 1
Gene Aliases: DCE; DHCR24; KIAA0018; Nbla03646; seladin-1; SELADIN1
UniProt ID: (Human) Q15392
Entrez Gene ID: (Human) 1718
Molecular Function: oxidoreductase reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.