Novus Biologicals
Manufacturer Code:NBP157906
Catalog # NBP157906
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PLA2G5(phospholipase A2 group V) The peptide sequence was selected from the middle region of PLA2G5. Peptide sequence YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Ca2+-dependent phospholipase A2; Ca2+-dependent phospholipase A2 calcium-dependent phospholipase A2 DKFZp686C2294 EC 3.1.1.4 Group V phospholipase A2 GV-PLA2 hVPLA(2) MGC46205 Phosphatidylcholine 2-acylhydrolase 5 phospholipase A2 group V PLA2-10; Phosphatidylcholine 2-acylhydrolase 5; Phospholipase A2 group V; phospholipase A2, group V; PLA2-10
Gene Aliases: FRFB; GV-PLA2; hVPLA(2); PLA2-10; PLA2G5
UniProt ID: (Human) P39877
Entrez Gene ID: (Human) 5322
Molecular Function: hydrolase lipase phospholipase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.