Novus Biologicals
Manufacturer Code:NBP169190
Catalog # NBP169190
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SYT11 (synaptotagmin XI) The peptide sequence was selected from the N terminal of SYT11. Peptide sequence AGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp781D015 KIAA0080synaptotagmin 12 MGC10881 MGC17226 synaptotagmin XISYT12 synaptotagmin-11 SytXI; synaptotagmin 12; Synaptotagmin XI; Synaptotagmin-11; SytXI
Gene Aliases: KIAA0080; SYT11; SYT12; sytXI
UniProt ID: (Human) Q9BT88
Entrez Gene ID: (Human) 23208
Molecular Function:
membrane traffic protein
membrane trafficking regulatory protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.