Novus Biologicals
Manufacturer Code:NBP178303
Catalog # NBP178303
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human SUV420H1. Peptide Sequence NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: [histone H4]-lysine20 N-methyltransferase KMT5B; [histone H4]-N-methyl-L-lysine20 N-methyltransferase KMT5B; C630029K18Rik; C630029K18Rik CGI85 CGI-85 EC 2.1.1.43 histone-lysine N-methyltransferase SUV420H1 KMT5B KMT5B Lysine N-methyltransferase 5B MGC118906 MGC118909 MGC21161 MGC703 Su(var)4-20 homolog 1 Suppressor of variegation 4-20 homolog 1 suppressor of variegation 4-20 homolog 1 (Drosophila) suv4-20h1; Histone-lysine N-methyltransferase KMT5B; histone-lysine N-methyltransferase SUV420H1; lysine (K)-specific methyltransferase 5B; Lysine N-methyltransferase 5B; Lysine-specific methyltransferase 5B; Su(var)4-20 homolog 1; Suppressor of variegation 4-20 homolog 1; suv4-20h1
Gene Aliases: CGI-85; CGI85; KMT5B; SUV420H1
UniProt ID: (Human) Q4FZB7
Entrez Gene ID: (Human) 51111
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.