Novus Biologicals
Manufacturer Code:NBP230524
Catalog # NBP230524
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EGFFGEKNEHCECHTCERKGEGAFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: [histone H4]-lysine20 N-methyltransferase KMT5B; [histone H4]-N-methyl-L-lysine20 N-methyltransferase KMT5B; EC 2.1.1.43 FLJ98627 histone-lysine N-methyltransferase SUV420H2 KMT5Csuv4-20h2 Lysine N-methyltransferase 5C MGC2705 Su(var)4-20 homolog 2 Suppressor of variegation 4-20 homolog 2 suppressor of variegation 4-20 homolog 2 (Drosophila) Suv4-20h2; Histone-lysine N-methyltransferase KMT5C; histone-lysine N-methyltransferase SUV420H2; lysine (K)-specific methyltransferase 5C; Lysine N-methyltransferase 5C; Lysine-specific methyltransferase 5C; Su(var)4-20 homolog 2; Suppressor of variegation 4-20 homolog 2; suv4-20h2
Gene Aliases: KMT5C; PP7130; SUV420H2
UniProt ID: (Human) Q86Y97
Entrez Gene ID: (Human) 84787
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.