Novus Biologicals
Manufacturer Code:NBP238828
Catalog # NBP238828
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ23414Histone H3-K9 methyltransferase 2 H3-K9-HMTase 2 histone-lysine N-methyltransferase SUV39H2 KMT1BEC 2.1.1.43 Lysine N-methyltransferase 1B Su(var)3-9 homolog 2 Suppressor of variegation 3-9 homolog 2 suppressor of variegation 3-9 homolog 2 (Drosophila); H3-K9-HMTase 2; Histone H3-K9 methyltransferase 2; Histone-lysine N-methyltransferase SUV39H2; Lysine N-methyltransferase 1B; Su(var)3-9 homolog 2; Suppressor of variegation 3-9 homolog 2
Gene Aliases: KMT1B; SUV39H2
UniProt ID: (Human) Q9H5I1
Entrez Gene ID: (Human) 79723
Molecular Function:
DNA binding protein
methyltransferase
nucleic acid binding
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.