Novus Biologicals
Manufacturer Code:NBP231904
Catalog # NBP231904
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Aryl sulfotransferase 2; Aryl sulfotransferase 2 arylamine sulfotransferase EC 2.8.2 EC 2.8.2.1 HAST4 MGC142287 MGC142289 Phenol sulfotransferase 2 phenolic-metabolizing (P) form of PST phenol-preferring phenol sulfotransferase2 Phenol-sulfating phenol sulfotransferase 2 P-PST 2 ST1A2 STP2P-PST sulfotransferase 1A2 sulfotransferase family cytosolic 1A phenol-preferring member 2 thermostable phenol sulfotransferase TSPST2; arylamine sulfotransferase; P-PST 2; Phenol sulfotransferase 2; phenol-preferring phenol sulfotransferase2; Phenol-sulfating phenol sulfotransferase 2; phenolic-metabolizing (P) form of PST; ST1A2; Sulfotransferase 1A2; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2; thermostable phenol sulfotransferase
Gene Aliases: HAST4; P-PST; ST1A2; STP2; SULT1A2; TSPST2
UniProt ID: (Human) P50226
Entrez Gene ID: (Human) 6799
Molecular Function:
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.