Novus Biologicals
Manufacturer Code:NBP15731120UL
Catalog # NBP157320UL
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to STRBP(spermatid perinuclear RNA binding protein) The peptide sequence was selected from the middle region of STRBP. Peptide sequence PSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp434N214 FLJ11307 FLJ14223 FLJ14984 ILF3L interleukin enhancer binding factor 3-like MGC21529 MGC3405 p74 spermatid perinuclear RNA binding protein spermatid perinuclear RNA-binding protein SPNRFLJ21960; epididymis luminal protein 162; Spermatid perinuclear RNA-binding protein
Gene Aliases: HEL162; ILF3L; p74; SPNR; STRBP
UniProt ID: (Human) Q96SI9
Entrez Gene ID: (Human) 55342
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.