Novus Biologicals
Manufacturer Code:NBP19849220UL
Catalog # NBP19849220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is STRA8 - C-terminal region (NP_872295). Peptide sequence PEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDED. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: stimulated by retinoic acid 8 homolog; stimulated by retinoic acid gene 8 homolog; stimulated by retinoic acid gene 8 homolog (mouse) stimulated by retinoic acid gene 8 protein homolog; Stimulated by retinoic acid gene 8 protein homolog; STRA8
Gene Aliases: STRA8
UniProt ID: (Human) Q7Z7C7
Entrez Gene ID: (Human) 346673
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.