Novus Biologicals
Manufacturer Code:NBP258008
Catalog # NBP258008
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.1.3.48 FLJ14427 Neural-specific protein-tyrosine phosphatase protein tyrosine phosphatase non-receptor type 5 (striatum-enriched) protein-tyrosine phosphatase striatum-enriched STEPPTPSTEP Striatum-enriched protein-tyrosine phosphatase tyrosine-protein phosphatase non-receptor type 5; Neural-specific protein-tyrosine phosphatase; protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched); protein-tyrosine phosphatase striatum-enriched; STEP; striatal-enriched protein tyrosine phosphatase; Striatum-enriched protein-tyrosine phosphatase; Tyrosine-protein phosphatase non-receptor type 5
Gene Aliases: PTPN5; PTPSTEP; STEP; STEP61
UniProt ID: (Human) P54829
Entrez Gene ID: (Human) 84867
Molecular Function: hydrolase phosphatase protein phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.