Novus Biologicals
Manufacturer Code:NBP230538
Catalog # NBP230538
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: StAR-related lipid transfer (START) domain containing 4; StAR-related lipid transfer domain containing 4; StAR-related lipid transfer protein 4; StARD4; StARD4 StAR-related lipid transfer (START) domain containing 4 stAR-related lipid transfer protein 4 START domain containing 4 sterol-regulated START domain-containing protein 4 sterol regulated; START domain containing 4, sterol regulated; START domain-containing protein 4
Gene Aliases: STARD4
UniProt ID: (Human) Q96DR4
Entrez Gene ID: (Human) 134429
Molecular Function:
membrane traffic protein
transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.