Novus Biologicals
Manufacturer Code:NBP170716
Catalog # NBP170716
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ST8SIA6(ST8 alpha-N-acetyl-neuraminide alpha-28-sialyltransferase 6) The peptide sequence was selected from the middle region of ST8SIA6. Peptide sequence LEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 8-sialyltransferase) alpha-28-sialyltransferase 8F alpha-28-sialyltransferase 8F variant 2 SIA8F sialytransferase St8Sia VI SIAT8F ST8 alpha-N-acetyl-neuraminide alpha-28-sialyltransferase 6 ST8SiaVI ST8SIA-VI; Alpha-2,8-sialyltransferase 8F; alpha-2,8-sialyltransferase 8F variant 1; alpha-2,8-sialyltransferase 8F variant 2; alpha-2,8-sialyltransferase 8F variant 3; Sialyltransferase 8F; sialyltransferase 8F (alpha-2, 8-sialyltransferase); Sialyltransferase St8Sia VI; sialytransferase St8Sia VI; SIAT8-F; ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 6; ST8SiaVI
Gene Aliases: SIA8F; SIAT8F; ST8SIA-VI; ST8SIA6
UniProt ID: (Human) P61647
Entrez Gene ID: (Human) 338596
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.