Novus Biologicals
Manufacturer Code:NBP213393
Catalog # NBP213393
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSS LVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alpha-2,8-sialyltransferase 8D; Alpha-28-sialyltransferase 8D CMP-N-acetylneuraminate-poly-alpha-28-sialyl transferase CMP-N-acetylneuraminate-poly-alpha-28-sialyltransferase EC 2.4.99 EC 2.4.99.- Polysialyltransferase-1 PST1MGC61459 PSTMGC34450 sialyltransferase 8 (alpha-2 8-polysialytransferase) D Sialyltransferase 8D Sialytransferase St8Sia IV SIAT8D SIAT8-D ST8 alpha-N-acetyl-neuraminide alpha-28-sialyltransferase 4 ST8SiaIV ST8SIA-IV; CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase; CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase; Polysialyltransferase-1; sialyltransferase 8 (alpha-2, 8-polysialytransferase) D; Sialyltransferase 8D; Sialyltransferase St8Sia IV; sialytransferase St8Sia IV; SIAT8-D; ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 4; ST8SiaIV
Gene Aliases: PST; PST1; SIAT8D; ST8SIA-IV; ST8SIA4
UniProt ID: (Human) Q92187
Entrez Gene ID: (Human) 7903
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.