Novus Biologicals
Manufacturer Code:NBP231603
Catalog # NBP231603
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EVNFPLLLNCFGQPGTKWIPFSYTYRRPLRTHYGYINVKTQEPLQLDCDL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3; alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase III; alpha-N-acetylgalactosaminide alpha-26-sialyltransferase 3 alpha-N-acetylgalactosaminide alpha-26-sialyltransferase III EC 2.4.99.- EC 2.4.99.7 FLJ13669 FLJ27239 GalNAc alpha-26-sialyltransferase III PRO7177 sialyltransferase 7((alpha-N-acetylneuraminyl-23-beta-galactosyl-13)-N-acetyl galactosaminidealpha-26-sialyltransferase) C Sialyltransferase 7C SIAT7C SIAT7-C ST6 (alpha-N-acetyl-neuraminyl-23-beta-galactosyl-13)-N-acetylgalactosaminidealpha-26-sialyltran ST6 (alpha-N-acetyl-neuraminyl-23-beta-galactosyl-13)-N-acetylgalactosaminidealpha-26-sialyltransferase 3 ST6GalNAc III ST6GALNACIII STY; GalNAc alpha-2,6-sialyltransferase III; sialyltransferase 7 ((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialyltransferase) C; Sialyltransferase 7C; SIAT7-C; ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltran; ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3; ST6 GalNAc alpha-2,6-sialyltransferase 3; ST6GALNAC III; ST6GalNAcIII; STY
Gene Aliases: PRO7177; SIAT7C; ST6GALNAC3; ST6GALNACIII; STY; UNQ2787/PRO7177
UniProt ID: (Human) Q8NDV1
Entrez Gene ID: (Human) 256435
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.