Novus Biologicals
Manufacturer Code:NBP174154
Catalog # NBP174154
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the C terminal of St6gal2. Immunizing peptide sequence RGLSSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alpha 2,6-ST 2; Alpha 26-ST 2 beta-galactoside alpha-26-sialyltransferase 2 beta-galactoside alpha-26-sialyltransferase II CMP-N-acetylneuraminate-beta-galactosamide-alpha-26-sialyltransferase 2 EC 2.4.99 EC 2.4.99.1 FLJ30711 FLJ37730 FLJ38334 hST6Gal II KIAA1877St6gal2 Sialyltransferase 2 sialyltransferase 2 (monosialoganglioside sialyltransferase) SIAT2 ST6 beta-galactosamide alpha-26-sialyltranferase 2 ST6Gal II ST6GALII; Beta-galactoside alpha-2,6-sialyltransferase 2; beta-galactoside alpha-2,6-sialyltransferase II; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2; sialyltransferase; Sialyltransferase 2; sialyltransferase 2 (monosialoganglioside sialyltransferase); ST6 beta-galactosamide alpha-2,6-sialyltranferase 2; ST6Gal II; ST6GalII
Gene Aliases: KIAA1877; SIAT2; ST6GAL2; ST6GalII
UniProt ID: (Human) Q96JF0
Entrez Gene ID: (Human) 84620
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.