Novus Biologicals
Manufacturer Code:NBP162444
Catalog # NBP162444
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ST3GAL5(ST3 beta-galactoside alpha-23-sialyltransferase 5) The peptide sequence was selected from the N terminal of ST3GAL5 (NP_003887). Peptide sequence DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alpha 2,3-sialyltransferase V; alpha 23-sialyltransferase V CMP-NeuAc:lactosylceramide alpha-23-sialyltransferase EC 2.4.99.9 Ganglioside GM3 synthase GM3 synthase lactosylceramide alpha-23-sialyltransferase Sialyltransferase 9 sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-23-sialyltransferaseGM3 synthase) SIATGM3S ST3 beta-galactoside alpha-23-sialyltransferase 5 ST3Gal V ST3GALV ST3GalVSIAT9SATI; CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; Ganglioside GM3 synthase; GM3 synthase; Lactosylceramide alpha-2,3-sialyltransferase; Sialyltransferase 9; sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; GM3 synthase); ST3 beta-galactoside alpha-23-sialyltransferase 5; ST3Gal V; ST3GalV
Gene Aliases: SATI; SIAT9; SIATGM3S; ST3GAL5; ST3GalV; UNQ2510/PRO5998
UniProt ID: (Human) Q9UNP4
Entrez Gene ID: (Human) 8869
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.