Novus Biologicals
Manufacturer Code:NBP160067
Catalog # NBP160067
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ST3GAL3(ST3 beta-galactoside alpha-23-sialyltransferase 3) The peptide sequence was selected from the C terminal of ST3GAL3. Peptide sequence GFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alpha 2,3-sialyltransferase III; Alpha 2,3-ST 3; alpha 23-sialyltransferase III Alpha 23-ST 3 alpha-23-sialyltransferase II Beta-galactoside alpha-23-sialyltransferase 3 CMP-N-acetylneuraminate-beta-14-galactoside alpha-23-sialyltransferase EC 2.4.99.6 Gal beta-13(4) GlcNAc alpha-23 sialyltransferase Gal beta-13(4)GlcNAc alpha-23 sialyltransferase N-acetyllactosaminide alpha-23-sialyltransferase Sialyltransferase 6 SIAT6sialyltransferase 6 (N-acetyllacosaminide alpha 23-sialyltransferase) ST3 beta-galactoside alpha-23-sialyltransferase 3 ST3Gal III ST3GALII ST3GalIII ST3N; alpha-2,3-sialyltransferase II; Beta-galactoside alpha-2,3-sialyltransferase 3; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase; Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase; mental retardation, non-syndromic, autosomal recessive, 12; N-acetyllactosaminide alpha-2,3-sialyltransferase; Sialyltransferase 6; sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase); ST3Gal III; ST3GalIII; ST3N
Gene Aliases: EIEE15; MRT12; SIAT6; ST3GAL3; ST3GALII; ST3GalIII; ST3N
UniProt ID: (Human) Q11203
Entrez Gene ID: (Human) 6487
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.