Novus Biologicals
Manufacturer Code:NBP16255820UL
Catalog # NBP16255820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ST3GAL2(ST3 beta-galactoside alpha-23-sialyltransferase 2) The peptide sequence was selected form the C terminal of ST3GAL2. Peptide sequence ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alpha 2,3-ST 2; Alpha 23-ST 2 Beta-galactoside alpha-23-sialyltransferase 2 beta-galactoside alpha-23-sialytransferase CMP-N-acetylneuraminate-beta-galactosamide-alpha-23-sialyltransferase 2 EC 2.4.99.4 EC 2.4.99.7 Gal-beta-13-GalNAc-alpha-23-sialyltransferase Gal-NAc6S Sialyltransferase 4B sialyltransferase 4B (beta-galactosidase alpha-23-sialytransferase) SIAT4B SIAT4-B ST3 beta-galactoside alpha-23-sialyltransferase 2 ST3GalA.2ST3Gal II ST3GALII; beta-galactoside alpha-2,3-sialyltransferase 2; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2; Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase; Gal-NAc6S; Monosialoganglioside sialyltransferase; Sialyltransferase 4B; sialyltransferase 4B (beta-galactosidase alpha-2,3-sialytransferase); SIAT4-B; ST3Gal II; ST3GalA.2; ST3GalII
Gene Aliases: Gal-NAc6S; SIAT4B; ST3GAL2; ST3GalA.2; ST3GALII
UniProt ID: (Human) Q16842
Entrez Gene ID: (Human) 6483
Molecular Function: glycosyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.