Novus Biologicals
Manufacturer Code:NBP157137
Catalog # NBP157137
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SRP68(signal recognition particle 68kDa) The peptide sequence was selected from the N terminal of SRP68. Peptide sequence EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Signal recognition particle 68 kDa protein; signal recognition particle 68 kDa protein signal recognition particle 68kD signal recognition particle 68kDa; signal recognition particle 68kD; signal recognition particle 68kDa; Signal recognition particle subunit SRP68; SRP68
Gene Aliases: SRP68
UniProt ID: (Human) Q9UHB9
Entrez Gene ID: (Human) 6730
Molecular Function:
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.