Novus Biologicals
Manufacturer Code:NBP276535
Catalog # NBP276535
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSM |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
Protein Aliases: bHLHd1; BHLHD1 Class D basic helix-loop-helix protein 1 SREBP 1c SREBP-1 SREBP1bHLHd1SREBP-1c sterol regulatory element binding protein-1 sterol regulatory element binding transcription factor 1 sterol regulatory element-binding protein 1 Sterol regulatory element-binding transcription factor 1; Class D basic helix-loop-helix protein 1; Processed sterol regulatory element-binding protein 1; SREBP-1; Sterol regulatory element-binding protein 1; Sterol regulatory element-binding transcription factor 1; Transcription factor SREBF1
Gene Aliases: BHLHD1; SREBF1; SREBP-1c; SREBP1; SREBP1a
UniProt ID: (Human) P36956
Entrez Gene ID: (Human) 6720
Molecular Function:
basic helix-loop-helix transcription factor
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.