Novus Biologicals
Manufacturer Code:NBP182259
Catalog # NBP182259
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-oxo-5-alpha-steroid 4-dehydrogenase 3; 3-oxo-5-alpha-steroid 4-dehydrogenase 3 CDG1P EC 1.3.1.- EC 1.3.99.5 FLJ13352 probable polyprenol reductase S5AR 3 SR type 3 SRD5A2L1 SRD5A2LCDG1Q steroid 5 alpha-reductase 3 Steroid 5-alpha-reductase 2-like Steroid 5-alpha-reductase 3; Polyprenol reductase; probable polyprenol reductase; S5AR 3; SR type 3; Steroid 5-alpha-reductase 2-like; Steroid 5-alpha-reductase 3
Gene Aliases: CDG1P; CDG1Q; KRIZI; SRD5A2L; SRD5A2L1; SRD5A3
UniProt ID: (Human) Q9H8P0
Entrez Gene ID: (Human) 79644
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.