Novus Biologicals
Manufacturer Code:NBP16247920UL
Catalog # NBP16247920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SRD5A2(steroid-5-alpha-reductase alpha polypeptide 2) The peptide sequence was selected form the N terminal of SRD5A2. Peptide sequence MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-oxo-5-alpha-steroid 4-dehydrogenase 2; 3-oxo-5-alpha-steroid 4-dehydrogenase 25 alpha-SR2 EC 1.3.99.5 MGC138457 S5AR 2 SR type 2 Steroid 5-alpha-reductase 23-oxo-5 alpha-steroid 4-dehydrogenase 2 steroid-5-alpha-reductase alpha polypeptide 2 (3-oxo-5 alpha-steroid delta4-dehydrogenase alpha 2) Type II 5-alpha reductase; 5 alpha-SR2; S5AR 2; SR type 2; Steroid 5-alpha-reductase 2; steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2); Type II 5-alpha reductase
Gene Aliases: SRD5A2
UniProt ID: (Human) P31213
Entrez Gene ID: (Human) 6716
Molecular Function:
dehydrogenase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.