Novus Biologicals
Manufacturer Code:NBP19843120UL
Catalog # NBP1984320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is Sqrdl - C-terminal region. Peptide sequence AQSGILDRTMCLIMKNQRPIKKYDGYTSCPLVTGYNRVILAEFDYTAQPL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CGI-44 sulfide dehydrogenase like sulfide quinone reductase-like (yeast) sulfide:quinone oxidoreductase mitochondrial; SQOR; sulfide dehydrogenase like; Sulfide dehydrogenase-like; Sulfide quinone oxidoreductase; Sulfide:quinone oxidoreductase, mitochondrial
Gene Aliases: CGI-44; PRO1975; SQOR; SQRDL
UniProt ID: (Human) Q9Y6N5
Entrez Gene ID: (Human) 58472
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.